Lineage for d1r9za2 (1r9z A:56-375)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571126Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1571363Family c.1.9.5: Cytosine deaminase catalytic domain [69390] (1 protein)
    automatically mapped to Pfam PF13147
    automatically mapped to Pfam PF07969
  6. 1571364Protein Cytosine deaminase catalytic domain [69391] (1 species)
  7. 1571365Species Escherichia coli [TaxId:562] [69392] (8 PDB entries)
    Uniprot P25524
  8. 1571367Domain d1r9za2: 1r9z A:56-375 [111755]
    Other proteins in same PDB: d1r9za1
    complexed with fe, gol, mg; mutant

Details for d1r9za2

PDB Entry: 1r9z (more details), 1.32 Å

PDB Description: bacterial cytosine deaminase d314s mutant.
PDB Compounds: (A:) Cytosine deaminase

SCOPe Domain Sequences for d1r9za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9za2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]}
pfvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiang
iqhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrl
gadvvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahh
egmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgi
trvkemlesginvcfghdsvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlith
hsartlnlqdygiaagnsan

SCOPe Domain Coordinates for d1r9za2:

Click to download the PDB-style file with coordinates for d1r9za2.
(The format of our PDB-style files is described here.)

Timeline for d1r9za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r9za1