Lineage for d1r9za1 (1r9z A:4-55,A:376-426)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810354Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1810355Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1810404Family b.92.1.2: Cytosine deaminase [69373] (1 protein)
  6. 1810405Protein Cytosine deaminase [69374] (1 species)
  7. 1810406Species Escherichia coli [TaxId:562] [69375] (8 PDB entries)
    Uniprot P25524
  8. 1810408Domain d1r9za1: 1r9z A:4-55,A:376-426 [111754]
    Other proteins in same PDB: d1r9za2
    complexed with fe, gol, mg; mutant

Details for d1r9za1

PDB Entry: 1r9z (more details), 1.32 Å

PDB Description: bacterial cytosine deaminase d314s mutant.
PDB Compounds: (A:) Cytosine deaminase

SCOPe Domain Sequences for d1r9za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9za1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli [TaxId: 562]}
alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipXliilpae
ngfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr

SCOPe Domain Coordinates for d1r9za1:

Click to download the PDB-style file with coordinates for d1r9za1.
(The format of our PDB-style files is described here.)

Timeline for d1r9za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r9za2