![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.2: Cytosine deaminase [69373] (1 protein) |
![]() | Protein Cytosine deaminase [69374] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69375] (8 PDB entries) |
![]() | Domain d1r9za1: 1r9z A:4-55,A:376-426 [111754] Other proteins in same PDB: d1r9za2 complexed with fe, gol, mg; mutant |
PDB Entry: 1r9z (more details), 1.32 Å
SCOP Domain Sequences for d1r9za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9za1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli} alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipXliilpae ngfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr
Timeline for d1r9za1: