Lineage for d1r9ya1 (1r9y A:4-55,A:376-426)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561510Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1561511Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1561560Family b.92.1.2: Cytosine deaminase [69373] (1 protein)
  6. 1561561Protein Cytosine deaminase [69374] (1 species)
  7. 1561562Species Escherichia coli [TaxId:562] [69375] (8 PDB entries)
    Uniprot P25524
  8. 1561568Domain d1r9ya1: 1r9y A:4-55,A:376-426 [111752]
    Other proteins in same PDB: d1r9ya2
    complexed with fe, gol, mg; mutant

Details for d1r9ya1

PDB Entry: 1r9y (more details), 1.57 Å

PDB Description: bacterial cytosine deaminase d314a mutant.
PDB Compounds: (A:) Cytosine deaminase

SCOPe Domain Sequences for d1r9ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9ya1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli [TaxId: 562]}
alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipXliilpae
ngfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr

SCOPe Domain Coordinates for d1r9ya1:

Click to download the PDB-style file with coordinates for d1r9ya1.
(The format of our PDB-style files is described here.)

Timeline for d1r9ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r9ya2