Class b: All beta proteins [48724] (178 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.2: Cytosine deaminase [69373] (1 protein) |
Protein Cytosine deaminase [69374] (1 species) |
Species Escherichia coli [TaxId:562] [69375] (8 PDB entries) Uniprot P25524 |
Domain d1r9xa1: 1r9x A:4-55,A:376-426 [111750] Other proteins in same PDB: d1r9xa2 complexed with fe, gol, mg; mutant |
PDB Entry: 1r9x (more details), 1.58 Å
SCOPe Domain Sequences for d1r9xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9xa1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli [TaxId: 562]} alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipXliilpae ngfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr
Timeline for d1r9xa1: