Lineage for d1r9xa1 (1r9x A:4-55,A:376-426)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678879Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 678880Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (8 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 678921Family b.92.1.2: Cytosine deaminase [69373] (1 protein)
  6. 678922Protein Cytosine deaminase [69374] (1 species)
  7. 678923Species Escherichia coli [TaxId:562] [69375] (8 PDB entries)
  8. 678931Domain d1r9xa1: 1r9x A:4-55,A:376-426 [111750]
    Other proteins in same PDB: d1r9xa2
    complexed with fe, gol, mg; mutant

Details for d1r9xa1

PDB Entry: 1r9x (more details), 1.58 Å

PDB Description: bacterial cytosine deaminase d314g mutant.
PDB Compounds: (A:) Cytosine deaminase

SCOP Domain Sequences for d1r9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9xa1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli [TaxId: 562]}
alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipXliilpae
ngfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr

SCOP Domain Coordinates for d1r9xa1:

Click to download the PDB-style file with coordinates for d1r9xa1.
(The format of our PDB-style files is described here.)

Timeline for d1r9xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r9xa2