Lineage for d1r9tj_ (1r9t J:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1712169Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 1712170Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 1712171Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 1712172Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 1712173Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 1712266Domain d1r9tj_: 1r9t J: [111746]
    protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn

Details for d1r9tj_

PDB Entry: 1r9t (more details), 3.5 Å

PDB Description: rna polymerase ii strand separated elongation complex, mismatched nucleotide
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

SCOPe Domain Sequences for d1r9tj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9tj_ i.8.1.1 (J:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d1r9tj_:

Click to download the PDB-style file with coordinates for d1r9tj_.
(The format of our PDB-style files is described here.)

Timeline for d1r9tj_: