SCOPe 2.08: Domain d1r9tj_: 1r9t J:

Lineage for d1r9tj_ (1r9t J:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1r9tj_: 1r9t J: [111746]
   protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn

Details for d1r9tj_

PDB Entry: 1r9t, 3.5 Å

PDB Description: rna polymerase ii strand separated elongation complex, mismatched nucleotide

PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

SCOPe Domain Sequences for d1r9tj_:

Sequence; same for both SEQRES and ATOM records:

>d1r9tj_ i.8.1.1 (J:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d1r9tj_:

• d1r9tj_ first appeared in SCOP 1.71
  
• d1r9tj_ appears in SCOPe 2.07