![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.8: RNA polymerase [58180] (1 superfamily) |
![]() | Superfamily i.8.1: RNA polymerase [58181] (1 family) ![]() |
![]() | Family i.8.1.1: RNA polymerase [58182] (2 proteins) |
![]() | Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries) |
![]() | Domain d1r9ti_: 1r9t I: [111745] protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn |
PDB Entry: 1r9t (more details), 3.5 Å
SCOPe Domain Sequences for d1r9ti_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9ti_ i.8.1.1 (I:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrhelitnigetagvvqd igsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshiftsdqknkrtq
Timeline for d1r9ti_: