Lineage for d1r9sk_ (1r9s K:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 755052Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 755053Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 755054Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 755055Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 755056Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (18 PDB entries)
  8. 755192Domain d1r9sk_: 1r9s K: [111737]

Details for d1r9sk_

PDB Entry: 1r9s (more details), 4.25 Å

PDB Description: rna polymerase ii strand separated elongation complex, matched nucleotide
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOP Domain Sequences for d1r9sk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9sk_ i.8.1.1 (K:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOP Domain Coordinates for d1r9sk_:

Click to download the PDB-style file with coordinates for d1r9sk_.
(The format of our PDB-style files is described here.)

Timeline for d1r9sk_: