Lineage for d1r9ja3 (1r9j A:527-669)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488516Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 2488535Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 2488560Species Leishmania mexicana mexicana [TaxId:44270] [117610] (1 PDB entry)
    Uniprot Q8MPM3
  8. 2488561Domain d1r9ja3: 1r9j A:527-669 [111724]
    Other proteins in same PDB: d1r9ja1, d1r9ja2, d1r9ja4, d1r9jb1, d1r9jb2, d1r9jb4
    complexed with ca, tpp

Details for d1r9ja3

PDB Entry: 1r9j (more details), 2.22 Å

PDB Description: Transketolase from Leishmania mexicana
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d1r9ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9ja3 c.48.1.1 (A:527-669) Transketolase (TK), C-domain {Leishmania mexicana mexicana [TaxId: 44270]}
ssiegvrhgaysvvdvpdlqlvivasgsevslavdaakalsgelrvrvvsmpcqelfdaq
pdtyrqavlpagvpvvsveayvsfgwekyshahvgmsgfgasapagvlykkfgitveevv
rtgrelakrfpdgtaplknssfs

SCOPe Domain Coordinates for d1r9ja3:

Click to download the PDB-style file with coordinates for d1r9ja3.
(The format of our PDB-style files is described here.)

Timeline for d1r9ja3: