SCOPe 2.05: Domain d1r9ja3: 1r9j A:527-669

Lineage for d1r9ja3 (1r9j A:527-669)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)

6. Protein Transketolase (TK), C-domain [52924] (4 species)
   two N-terminal domains are PP and Pyr modules of thiamin-binding fold

7. Species Leishmania mexicana mexicana [TaxId:44270] [117610] (1 PDB entry)
   Uniprot Q8MPM3

8. Domain d1r9ja3: 1r9j A:527-669 [111724]
   Other proteins in same PDB: d1r9ja1, d1r9ja2, d1r9jb1, d1r9jb2
   complexed with ca, tpp

Details for d1r9ja3

PDB Entry: 1r9j, 2.22 Å

PDB Description: Transketolase from Leishmania mexicana

PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d1r9ja3:

Sequence; same for both SEQRES and ATOM records:

>d1r9ja3 c.48.1.1 (A:527-669) Transketolase (TK), C-domain {Leishmania mexicana mexicana [TaxId: 44270]}
ssiegvrhgaysvvdvpdlqlvivasgsevslavdaakalsgelrvrvvsmpcqelfdaq
pdtyrqavlpagvpvvsveayvsfgwekyshahvgmsgfgasapagvlykkfgitveevv
rtgrelakrfpdgtaplknssfs

Timeline for d1r9ja3:

• d1r9ja3 first appeared in SCOP 1.71
  
• d1r9ja3 appears in SCOPe 2.04
  
• d1r9ja3 appears in SCOPe 2.06
  
• d1r9ja3 appears in the current release, SCOPe 2.08