Lineage for d1r8lb_ (1r8l B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 815772Protein Beta-1,4-galactanase [89469] (4 species)
  7. 815773Species Bacillus licheniformis [TaxId:1402] [117367] (5 PDB entries)
    Uniprot Q65CX5 36-422
    Uniprot Q65CX5 28-424
    Uniprot Q65CX5 36-422 ! Uniprot Q65CX5 28-424
  8. 815779Domain d1r8lb_: 1r8l B: [111719]
    complexed with ca

Details for d1r8lb_

PDB Entry: 1r8l (more details), 2.6 Å

PDB Description: The structure of endo-beta-1,4-galactanase from Bacillus licheniformis
PDB Compounds: (B:) endo-beta-1,4-galactanase

SCOP Domain Sequences for d1r8lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8lb_ c.1.8.3 (B:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtpf

SCOP Domain Coordinates for d1r8lb_:

Click to download the PDB-style file with coordinates for d1r8lb_.
(The format of our PDB-style files is described here.)

Timeline for d1r8lb_: