SCOP 1.75: Domain d1r83a_: 1r83 A:

Lineage for d1r83a_ (1r83 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries)
   Uniprot P61991

8. Domain d1r83a_: 1r83 A: [111717]
   Sso7a variant
   mutant

Details for d1r83a_

PDB Entry: 1r83

PDB Description: Solution structure of Sso7d mutant (K12L), NMR, 4 structures

PDB Compounds: (A:) DNA-binding protein 7a

SCOP Domain Sequences for d1r83a_:

Sequence; same for both SEQRES and ATOM records:

>d1r83a_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

Timeline for d1r83a_:

• d1r83a_ first appeared in SCOP 1.71
  
• d1r83a_ appears in SCOP 1.73
  
• d1r83a_ does not appear in SCOPe 2.01