Lineage for d1r7ma1 (1r7m A:3-120)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608385Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 608392Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 608393Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
    contains two extra helices in the C-terminal extension
  6. 608441Protein DNA endonuclease I-SceI [118055] (1 species)
    duplication: contains tandem repeat of this fold
  7. 608442Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118056] (1 PDB entry)
  8. 608443Domain d1r7ma1: 1r7m A:3-120 [111713]

Details for d1r7ma1

PDB Entry: 1r7m (more details), 2.25 Å

PDB Description: The homing endonuclease I-SceI bound to its DNA recognition region

SCOP Domain Sequences for d1r7ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ma1 d.95.2.1 (A:3-120) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae)}
nikknqvmnlgpnskllkeyksqlielnieqfeagiglilgdayirsrdegktycmqfew
knkaymdhvcllydqwvlspphkkervnhlgnlvitwgaqtfkhqafnklanlfivnn

SCOP Domain Coordinates for d1r7ma1:

Click to download the PDB-style file with coordinates for d1r7ma1.
(The format of our PDB-style files is described here.)

Timeline for d1r7ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r7ma2