SCOP 1.73: Domain d1r6ya_: 1r6y A:

Lineage for d1r6ya_ (1r6y A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.11: PA3566-like [110970] (3 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein YgiN [117936] (1 species)

7. Species Escherichia coli [TaxId:562] [117937] (2 PDB entries)

8. Domain d1r6ya_: 1r6y A: [111711]
   Structural genomics target

Details for d1r6ya_

PDB Entry: 1r6y, 2.2 Å

PDB Description: Crystal structure of YgiN from Escherichia coli

PDB Compounds: (A:) Protein ygiN

SCOP Domain Sequences for d1r6ya_:

Sequence; same for both SEQRES and ATOM records:

>d1r6ya_ d.58.4.11 (A:) Hypothetical protein YgiN {Escherichia coli [TaxId: 562]}
mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg

Timeline for d1r6ya_:

• d1r6ya_ first appeared in SCOP 1.71
  
• d1r6ya_ appears in SCOP 1.75
  
• d1r6ya_ appears in the current release, SCOPe 2.08