Lineage for d1r6ya_ (1r6y A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603552Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 603669Family d.58.4.11: PA3566-like [110970] (3 proteins)
    subfamily of Pfam 03992
  6. 603679Protein Hypothetical protein YgiN [117936] (1 species)
  7. 603680Species Escherichia coli [TaxId:562] [117937] (2 PDB entries)
  8. 603682Domain d1r6ya_: 1r6y A: [111711]
    Structural genomics target

Details for d1r6ya_

PDB Entry: 1r6y (more details), 2.2 Å

PDB Description: Crystal structure of YgiN from Escherichia coli

SCOP Domain Sequences for d1r6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ya_ d.58.4.11 (A:) Hypothetical protein YgiN {Escherichia coli}
mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg

SCOP Domain Coordinates for d1r6ya_:

Click to download the PDB-style file with coordinates for d1r6ya_.
(The format of our PDB-style files is described here.)

Timeline for d1r6ya_: