Lineage for d1r6va_ (1r6v A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 583728Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 583729Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 583730Family c.41.1.1: Subtilases [52744] (13 proteins)
  6. 583740Protein Fervidolysin [117569] (1 species)
  7. 583741Species Fervidobacterium pennivorans [TaxId:93466] [117570] (1 PDB entry)
  8. 583742Domain d1r6va_: 1r6v A: [111710]
    complexed with ca; mutant

Details for d1r6va_

PDB Entry: 1r6v (more details), 1.7 Å

PDB Description: Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin

SCOP Domain Sequences for d1r6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans}
skakdlaslpeiksqgyhilfgelrdgeytegkilvgyndrsevdkivkavngkvvlelp
qikvvsiklngmtvkqaydkikalalkgiryvepsykrelikptvvkpnpdmykirkpgl
nstardygeelsnelwgleaigvtqqlweeasgtniivavvdtgvdgthpdlegqviagy
rpafdeelpagtdssyggsagthvagtiaakkdgkgivgvapgakimpivifddpalvgg
ngyvgddyvaagiiwatdhgakvmnhswggwgysytmkeafdyamehgvvmvvsagnnts
dshhqypagypgviqvaaldyyggtfrvagfssrsdgvsvgapgvtilstvpgedsigye
ghnenvpatnggtydyyqgtsmaaphvtgvvavllqkfpnakpwqirkllentafdfngn
gwdhdtgyglvkldaalqgplptqggveefqvvvtdakgnfgvptvfvsmmrdngscyya
ktgpdgiarfphidsgtydifvggpdhwdralapydgesipggyaialrmaeerqasfvg
fgvspdatqlnvnfnstlqvkfstnlstlkdpqfvvvdpllrgvygrvayarnqtydlsl
lsgqisfgiqtllpaatditiqgtvtlngedipvygvlkagttwtiiddfgglnlgtdsq
piyvwwtifgq

SCOP Domain Coordinates for d1r6va_:

Click to download the PDB-style file with coordinates for d1r6va_.
(The format of our PDB-style files is described here.)

Timeline for d1r6va_: