SCOPe 2.07: Domain d1r5sa1: 1r5s A:5-132

Lineage for d1r5sa1 (1r5s A:5-132)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.50: Connexin43 [118219] (1 superfamily)
   mostly unstructured; 2 helices, hairpin

4. Superfamily f.50.1: Connexin43 [118220] (1 family)

5. Family f.50.1.1: Connexin43 [118221] (1 protein)
   Pfam PF03508

6. Protein Gap junction alpha-1 protein, C-terminal domain [118222] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [118223] (1 PDB entry)
   Uniprot P08050 251-381

8. Domain d1r5sa1: 1r5s A:5-132 [111709]
   Other proteins in same PDB: d1r5sa2

Details for d1r5sa1

PDB Entry: 1r5s

PDB Description: connexin 43 carboxyl terminal domain

PDB Compounds: (A:) Gap junction alpha-1 protein

SCOPe Domain Sequences for d1r5sa1:

Sequence; same for both SEQRES and ATOM records:

>d1r5sa1 f.50.1.1 (A:5-132) Gap junction alpha-1 protein, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
spskdcgspkyayfngcssptaplspmsppgyklvtgdrnnsscrnynkqaseqnwanys
aeqnrmgqagstisnshaqpfdfpddnqnakkvaaghelqplaivdqrpssrassrassr
prpddlei

Timeline for d1r5sa1:

• d1r5sa1 first appeared in SCOP 1.71, called d1r5sa_
  
• d1r5sa1 appears in SCOPe 2.06
  
• d1r5sa1 appears in the current release, SCOPe 2.08