Lineage for d1r5sa_ (1r5s A:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 621184Fold f.50: Connexin43 [118219] (1 superfamily)
    mostly unstructured; 2 helices, hairpin
  4. 621185Superfamily f.50.1: Connexin43 [118220] (1 family) (S)
  5. 621186Family f.50.1.1: Connexin43 [118221] (1 protein)
    Pfam 03508
  6. 621187Protein Gap junction alpha-1 protein, C-terminal domain [118222] (1 species)
  7. 621188Species Rat (Rattus norvegicus) [TaxId:10116] [118223] (1 PDB entry)
  8. 621189Domain d1r5sa_: 1r5s A: [111709]

Details for d1r5sa_

PDB Entry: 1r5s (more details)

PDB Description: connexin 43 carboxyl terminal domain

SCOP Domain Sequences for d1r5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5sa_ f.50.1.1 (A:) Gap junction alpha-1 protein, C-terminal domain {Rat (Rattus norvegicus)}
gplgspskdcgspkyayfngcssptaplspmsppgyklvtgdrnnsscrnynkqaseqnw
anysaeqnrmgqagstisnshaqpfdfpddnqnakkvaaghelqplaivdqrpssrassr
assrprpddlei

SCOP Domain Coordinates for d1r5sa_:

Click to download the PDB-style file with coordinates for d1r5sa_.
(The format of our PDB-style files is described here.)

Timeline for d1r5sa_: