Lineage for d1r5kb_ (1r5k B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543453Protein Estrogen receptor alpha [48519] (1 species)
  7. 543454Species Human (Homo sapiens) [TaxId:9606] [48520] (19 PDB entries)
  8. 543478Domain d1r5kb_: 1r5k B: [111707]

Details for d1r5kb_

PDB Entry: 1r5k (more details), 2.7 Å

PDB Description: Human Estrogen Receptor alpha Ligand-Binding Domain In Complex With GW5638

SCOP Domain Sequences for d1r5kb_:

Sequence, based on SEQRES records: (download)

>d1r5kb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens)}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml

Sequence, based on observed residues (ATOM records): (download)

>d1r5kb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens)}
lalsltadqmvsalldaeppilyseydfseasmmglltnladrelvhminwakrvpgfvd
ltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
atssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihl
makagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml

SCOP Domain Coordinates for d1r5kb_:

Click to download the PDB-style file with coordinates for d1r5kb_.
(The format of our PDB-style files is described here.)

Timeline for d1r5kb_: