Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein) circularly permuted version of the "winged helix" fold |
Protein Methionine aminopeptidase, insert domain [46888] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [46890] (18 PDB entries) Uniprot P50579 110-478 |
Domain d1r5ha1: 1r5h A:375-448 [111704] Other proteins in same PDB: d1r5ha2 complexed with ao2, mn |
PDB Entry: 1r5h (more details), 2.4 Å
SCOPe Domain Sequences for d1r5ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5ha1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]} hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn lcdlgivdpypplc
Timeline for d1r5ha1: