Lineage for d1r5ga1 (1r5g A:375-448)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533625Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. 533626Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 533635Species Human (Homo sapiens) [TaxId:9606] [46890] (10 PDB entries)
  8. 533644Domain d1r5ga1: 1r5g A:375-448 [111702]
    Other proteins in same PDB: d1r5ga2
    complexed with ao1, mn

Details for d1r5ga1

PDB Entry: 1r5g (more details), 2 Å

PDB Description: Crystal Structure of MetAP2 complexed with A311263

SCOP Domain Sequences for d1r5ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ga1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens)}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

SCOP Domain Coordinates for d1r5ga1:

Click to download the PDB-style file with coordinates for d1r5ga1.
(The format of our PDB-style files is described here.)

Timeline for d1r5ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r5ga2