SCOPe 2.04: Domain d1r59x2: 1r59 X:257-491

Lineage for d1r59x2 (1r59 X:257-491)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
   Uniprot O34153 5-491

8. Domain d1r59x2: 1r59 X:257-491 [111700]

Details for d1r59x2

PDB Entry: 1r59, 2.5 Å

PDB Description: Enterococcus casseliflavus glycerol kinase

PDB Compounds: (X:) glycerol kinase

SCOPe Domain Sequences for d1r59x2:

Sequence; same for both SEQRES and ATOM records:

>d1r59x2 c.55.1.4 (X:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
fekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvagsaiqw
lrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrgttked
fvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidvqraan
lettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqav

Timeline for d1r59x2:

• d1r59x2 first appeared in SCOP 1.71
  
• d1r59x2 appears in SCOPe 2.03
  
• d1r59x2 appears in SCOPe 2.05
  
• d1r59x2 appears in the current release, SCOPe 2.08