Lineage for d1r59x2 (1r59 X:257-491)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586265Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) (S)
    duplication contains two domains of this fold
  5. 586507Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 586508Protein Glycerol kinase [53090] (2 species)
  7. 586509Species Enterococcus casseliflavus [TaxId:37734] [117641] (2 PDB entries)
  8. 586513Domain d1r59x2: 1r59 X:257-491 [111700]

Details for d1r59x2

PDB Entry: 1r59 (more details), 2.5 Å

PDB Description: Enterococcus casseliflavus glycerol kinase

SCOP Domain Sequences for d1r59x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r59x2 c.55.1.4 (X:257-491) Glycerol kinase {Enterococcus casseliflavus}
fekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvagsaiqw
lrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrgttked
fvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidvqraan
lettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqav

SCOP Domain Coordinates for d1r59x2:

Click to download the PDB-style file with coordinates for d1r59x2.
(The format of our PDB-style files is described here.)

Timeline for d1r59x2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r59x1