Lineage for d1r59x2 (1r59 X:257-491)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884335Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 2884336Protein Glycerol kinase [53090] (2 species)
  7. 2884337Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
    Uniprot O34153 5-491
  8. 2884373Domain d1r59x2: 1r59 X:257-491 [111700]

Details for d1r59x2

PDB Entry: 1r59 (more details), 2.5 Å

PDB Description: Enterococcus casseliflavus glycerol kinase
PDB Compounds: (X:) glycerol kinase

SCOPe Domain Sequences for d1r59x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r59x2 c.55.1.4 (X:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
fekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvagsaiqw
lrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrgttked
fvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidvqraan
lettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqav

SCOPe Domain Coordinates for d1r59x2:

Click to download the PDB-style file with coordinates for d1r59x2.
(The format of our PDB-style files is described here.)

Timeline for d1r59x2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r59x1