Lineage for d1r55a_ (1r55 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607714Family d.92.1.9: Reprolysin-like [55519] (2 proteins)
    Pfam 01421
  6. 607715Protein ADAM33 [118046] (1 species)
  7. 607716Species Human (Homo sapiens) [TaxId:9606] [118047] (2 PDB entries)
  8. 607717Domain d1r55a_: 1r55 A: [111694]
    complexed with 097, ca, cl, man, nag, zn

Details for d1r55a_

PDB Entry: 1r55 (more details), 1.58 Å

PDB Description: crystal structure of the catalytic domain of human adam 33

SCOP Domain Sequences for d1r55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens)}
trkylelyivadhtlfltrhrnlqhtkqrllevanyvdqllrtldiqvaltglevwterd
rsrvtqdanatlwaflqwrrglwaqrphdsaqlltgrafqgatvglapvegmcraessgg
vstdhselpigaaatmaheighslglshdpdgccveaaaesggcvmaaatghpfprvfsa
csrrqlraffrkgggaclsnaps

SCOP Domain Coordinates for d1r55a_:

Click to download the PDB-style file with coordinates for d1r55a_.
(The format of our PDB-style files is described here.)

Timeline for d1r55a_: