Lineage for d1r55a1 (1r55 A:208-409)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964135Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2964136Protein ADAM33 [118046] (1 species)
  7. 2964137Species Human (Homo sapiens) [TaxId:9606] [118047] (2 PDB entries)
    Uniprot Q9BZ11 204-409
  8. 2964138Domain d1r55a1: 1r55 A:208-409 [111694]
    Other proteins in same PDB: d1r55a2
    complexed with 097, ca, cl, zn

Details for d1r55a1

PDB Entry: 1r55 (more details), 1.58 Å

PDB Description: crystal structure of the catalytic domain of human adam 33
PDB Compounds: (A:) adam 33

SCOPe Domain Sequences for d1r55a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r55a1 d.92.1.9 (A:208-409) ADAM33 {Human (Homo sapiens) [TaxId: 9606]}
trkylelyivadhtlfltrhrnlqhtkqrllevanyvdqllrtldiqvaltglevwterd
rsrvtqdanatlwaflqwrrglwaqrphdsaqlltgrafqgatvglapvegmcraessgg
vstdhselpigaaatmaheighslglshdpdgccveaaaesggcvmaaatghpfprvfsa
csrrqlraffrkgggaclsnap

SCOPe Domain Coordinates for d1r55a1:

Click to download the PDB-style file with coordinates for d1r55a1.
(The format of our PDB-style files is described here.)

Timeline for d1r55a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r55a2