Lineage for d1r54a_ (1r54 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964135Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2964136Protein ADAM33 [118046] (1 species)
  7. 2964137Species Human (Homo sapiens) [TaxId:9606] [118047] (2 PDB entries)
    Uniprot Q9BZ11 204-409
  8. 2964139Domain d1r54a_: 1r54 A: [111693]
    complexed with ca, cl, zn

Details for d1r54a_

PDB Entry: 1r54 (more details), 1.85 Å

PDB Description: crystal structure of the catalytic domain of human adam33
PDB Compounds: (A:) adam 33

SCOPe Domain Sequences for d1r54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r54a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]}
earrtrkylelyivadhtlfltrhrnlqhtkqrllevanyvdqllrtldiqvaltglevw
terdrsrvtqdanatlwaflqwrrglwaqrphdsaqlltgrafqgatvglapvegmcrae
ssggvstdhselpigaaatmaheighslglshdpdgccveaaaesggcvmaaatghpfpr
vfsacsrrqlraffrkgggaclsnap

SCOPe Domain Coordinates for d1r54a_:

Click to download the PDB-style file with coordinates for d1r54a_.
(The format of our PDB-style files is described here.)

Timeline for d1r54a_: