SCOP 1.71: Domain d1r50b_: 1r50 B:

Lineage for d1r50b_ (1r50 B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (3 proteins)
   lack the first two strands of the common fold

6. Protein Lipase A [64145] (1 species)
   minimal alpha/beta hydrolase fold;

7. Species Bacillus subtilis [TaxId:1423] [64146] (6 PDB entries)

8. Domain d1r50b_: 1r50 B: [111692]
   complexed with sil

Details for d1r50b_

PDB Entry: 1r50, 1.45 Å

PDB Description: Bacillus subtilis lipase A with covalently bound Sc-IPG-phosphonate-inhibitor

SCOP Domain Sequences for d1r50b_:

Sequence; same for both SEQRES and ATOM records:

>d1r50b_ c.69.1.18 (B:) Lipase A {Bacillus subtilis}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

Timeline for d1r50b_:

• d1r50b_ is new in SCOP 1.71
  
• d1r50b_ appears in SCOP 1.73
  
• d1r50b_ appears in the current release, SCOPe 2.08