Lineage for d1r4za_ (1r4z A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900958Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2900979Protein Lipase A [64145] (4 species)
    minimal alpha/beta hydrolase fold;
  7. 2900980Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
    Uniprot P37957 34-212
  8. 2900990Domain d1r4za_: 1r4z A: [111689]
    complexed with ril

Details for d1r4za_

PDB Entry: 1r4z (more details), 1.8 Å

PDB Description: Bacillus subtilis lipase A with covalently bound Rc-IPG-phosphonate-inhibitor
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1r4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4za_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

SCOPe Domain Coordinates for d1r4za_:

Click to download the PDB-style file with coordinates for d1r4za_.
(The format of our PDB-style files is described here.)

Timeline for d1r4za_: