SCOPe 2.05: Domain d1r3ua_: 1r3u A:

Lineage for d1r3ua_ (1r3u A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [117671] (1 PDB entry)
   Uniprot Q8R7L0

8. Domain d1r3ua_: 1r3u A: [111681]
   complexed with act, mg

Details for d1r3ua_

PDB Entry: 1r3u, 2.5 Å

PDB Description: crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1r3ua_:

Sequence; same for both SEQRES and ATOM records:

>d1r3ua_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]}
pspmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlp
lsidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrk
prslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely

Timeline for d1r3ua_:

• d1r3ua_ first appeared in SCOP 1.71
  
• d1r3ua_ appears in SCOPe 2.04
  
• d1r3ua_ appears in SCOPe 2.06
  
• d1r3ua_ appears in the current release, SCOPe 2.08