Lineage for d1r3ua_ (1r3u A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588209Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 588210Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 588211Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (12 proteins)
  6. 588294Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 588309Species Thermoanaerobacter tengcongensis [117671] (1 PDB entry)
  8. 588310Domain d1r3ua_: 1r3u A: [111681]

Details for d1r3ua_

PDB Entry: 1r3u (more details), 2.5 Å

PDB Description: crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis

SCOP Domain Sequences for d1r3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ua_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Thermoanaerobacter tengcongensis}
pspmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlp
lsidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrk
prslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely

SCOP Domain Coordinates for d1r3ua_:

Click to download the PDB-style file with coordinates for d1r3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1r3ua_: