Lineage for d1r3ua_ (1r3u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891453Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 2891531Species Thermoanaerobacter tengcongensis [TaxId:119072] [117671] (1 PDB entry)
    Uniprot Q8R7L0
  8. 2891532Domain d1r3ua_: 1r3u A: [111681]
    complexed with act, mg

Details for d1r3ua_

PDB Entry: 1r3u (more details), 2.5 Å

PDB Description: crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1r3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ua_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]}
pspmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlp
lsidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrk
prslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely

SCOPe Domain Coordinates for d1r3ua_:

Click to download the PDB-style file with coordinates for d1r3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1r3ua_: