Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.35: Hypothetical protein VC1974 [117717] (1 protein) automatically mapped to Pfam PF00561 automatically mapped to Pfam PF12697 |
Protein Hypothetical protein VC1974 [117718] (1 species) |
Species Vibrio cholerae [TaxId:666] [117719] (1 PDB entry) Uniprot Q9KQM4 |
Domain d1r3da1: 1r3d A:2-263 [111680] Other proteins in same PDB: d1r3da2 Structural genomics target |
PDB Entry: 1r3d (more details), 1.9 Å
SCOPe Domain Sequences for d1r3da1:
Sequence, based on SEQRES records: (download)
>d1r3da1 c.69.1.35 (A:2-263) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} lsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnperhc dnfaeavemieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghf glqeneekaarwqhdqqwaqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlg ssvahmllatslakqpyllpalqalklpihyvcgeqdskfqqlaessglsysqvaqaghn vhheqpqafakivqamihsiid
>d1r3da1 c.69.1.35 (A:2-263) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} lsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnpaeav emieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghfglqenee kaarwqhdqqwaqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlgssvahml latslakqpyllpalqalklpihyvcgeqdskfqqlaessglsysqvaqaghnvhheqpq afakivqamihsiid
Timeline for d1r3da1: