SCOPe 2.06: Domain d1r3da1: 1r3d A:2-263

Lineage for d1r3da1 (1r3d A:2-263)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.35: Hypothetical protein VC1974 [117717] (1 protein)
   automatically mapped to Pfam PF00561
   automatically mapped to Pfam PF12697

6. Protein Hypothetical protein VC1974 [117718] (1 species)

7. Species Vibrio cholerae [TaxId:666] [117719] (1 PDB entry)
   Uniprot Q9KQM4

8. Domain d1r3da1: 1r3d A:2-263 [111680]
   Other proteins in same PDB: d1r3da2
   Structural genomics target

Details for d1r3da1

PDB Entry: 1r3d, 1.9 Å

PDB Description: crystal structure of protein vc1974 from vibrio cholerae, pfam abhydrolase

PDB Compounds: (A:) conserved hypothetical protein VC1974

SCOPe Domain Sequences for d1r3da1:

Sequence, based on SEQRES records:

>d1r3da1 c.69.1.35 (A:2-263) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}
lsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnperhc
dnfaeavemieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghf
glqeneekaarwqhdqqwaqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlg
ssvahmllatslakqpyllpalqalklpihyvcgeqdskfqqlaessglsysqvaqaghn
vhheqpqafakivqamihsiid

Sequence, based on observed residues (ATOM records):

>d1r3da1 c.69.1.35 (A:2-263) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}
lsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnpaeav
emieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghfglqenee
kaarwqhdqqwaqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlgssvahml
latslakqpyllpalqalklpihyvcgeqdskfqqlaessglsysqvaqaghnvhheqpq
afakivqamihsiid

Timeline for d1r3da1:

• d1r3da1 first appeared in SCOP 1.71, called d1r3da_
  
• d1r3da1 was called d1r3da_ in SCOPe 2.05
  
• d1r3da1 appears in SCOPe 2.07
  
• d1r3da1 appears in the current release, SCOPe 2.08