Lineage for d1r38a_ (1r38 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570948Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 570949Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 571066Protein Xylose reductase [75058] (1 species)
  7. 571067Species Fungi (Candida tenuis) [TaxId:45596] [75059] (5 PDB entries)
  8. 571074Domain d1r38a_: 1r38 A: [111676]

Details for d1r38a_

PDB Entry: 1r38 (more details), 2.2 Å

PDB Description: crystal structure of h114a mutant of candida tenuis xylose reductase

SCOP Domain Sequences for d1r38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r38a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis)}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

SCOP Domain Coordinates for d1r38a_:

Click to download the PDB-style file with coordinates for d1r38a_.
(The format of our PDB-style files is described here.)

Timeline for d1r38a_: