SCOPe: Structural Classification of Proteins — extended. Release 2.03 (October 2013)
Search SCOPe (example):

Lineage for d1r35a_ (1r35 A:)

  1. Root: SCOPe 2.03
  2. 1389709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433745Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1433746Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1433747Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 protein domains)
  6. 1433748Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1433916Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 1433954Domain d1r35a_: 1r35 A: [111673]
    complexed with h4b, hem, i58, so4

Details for d1r35a_

PDB Entry: 1r35 (more details)
PDB Description: murine inducible nitric oxide synthase oxygenase dimer, tetrahydrobiopterin and 4r-fluoro-n6-ethanimidoyl-l-lysine
PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d1r35a_:

Sequence, based on SEQRES records: (download)

>d1r35a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

Sequence, based on observed residues (ATOM records): (download)
>d1r35a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatssclgsimnpksltrgprdkptpleellphaiefinq
yygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnl
qvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryag
yqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlev
tmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqry
nileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqn
eyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

SCOPe Domain Coordinates for d1r35a_:

Click to download the PDB-style file with coordinates for d1r35a_.
(The format of our PDB-style files is described here.)

Timeline for d1r35a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r35b_


SCOPe Copyright © 1994-2014 The SCOP and SCOPe authors
scope@compbio.berkeley.edu