Lineage for d1r34a2 (1r34 A:523-1044)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 556788Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 556864Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 557116Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 557117Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 557118Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (9 PDB entries)
  8. 557124Domain d1r34a2: 1r34 A:523-1044 [111671]
    Other proteins in same PDB: d1r34a1, d1r34a3
    complexed with lks, mpd, nag, zn

Details for d1r34a2

PDB Entry: 1r34 (more details), 1.95 Å

PDB Description: golgi alpha-mannosidase ii complex with 5-thio-d- mannopyranosylamidinium salt

SCOP Domain Sequences for d1r34a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r34a2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster)}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOP Domain Coordinates for d1r34a2:

Click to download the PDB-style file with coordinates for d1r34a2.
(The format of our PDB-style files is described here.)

Timeline for d1r34a2: