Lineage for d1r34a1 (1r34 A:412-522)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310510Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) (S)
  5. 2310511Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 2310512Protein Golgi alpha-mannosidase II [88694] (1 species)
  7. 2310513Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 2310560Domain d1r34a1: 1r34 A:412-522 [111670]
    Other proteins in same PDB: d1r34a2, d1r34a3
    complexed with lks, mpd, nag, zn

Details for d1r34a1

PDB Entry: 1r34 (more details), 1.95 Å

PDB Description: golgi alpha-mannosidase ii complex with 5-thio-d- mannopyranosylamidinium salt
PDB Compounds: (A:) putative golgi alpha-mannosidase II

SCOPe Domain Sequences for d1r34a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r34a1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

SCOPe Domain Coordinates for d1r34a1:

Click to download the PDB-style file with coordinates for d1r34a1.
(The format of our PDB-style files is described here.)

Timeline for d1r34a1: