Lineage for d1r33a3 (1r33 A:31-411)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689577Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 689578Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 689579Protein Golgi alpha-mannosidase II [88715] (1 species)
  7. 689580Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (23 PDB entries)
  8. 689593Domain d1r33a3: 1r33 A:31-411 [111669]
    Other proteins in same PDB: d1r33a1, d1r33a2
    complexed with lka, mpd, nag, zn

Details for d1r33a3

PDB Entry: 1r33 (more details), 1.8 Å

PDB Description: golgi alpha-mannosidase ii complex with 5-thio-d-mannopyranosylamine
PDB Compounds: (A:) putative golgi alpha-mannosidase II

SCOP Domain Sequences for d1r33a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r33a3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
ragqaefptlsgdfftyadrs

SCOP Domain Coordinates for d1r33a3:

Click to download the PDB-style file with coordinates for d1r33a3.
(The format of our PDB-style files is described here.)

Timeline for d1r33a3: