Lineage for d1r33a2 (1r33 A:523-1044)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 945420Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 945547Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 945817Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 945818Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 945819Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (46 PDB entries)
    Uniprot Q24451 94-1107
  8. 945849Domain d1r33a2: 1r33 A:523-1044 [111668]
    Other proteins in same PDB: d1r33a1, d1r33a3
    complexed with lka, mpd, nag, zn

Details for d1r33a2

PDB Entry: 1r33 (more details), 1.8 Å

PDB Description: golgi alpha-mannosidase ii complex with 5-thio-d-mannopyranosylamine
PDB Compounds: (A:) putative golgi alpha-mannosidase II

SCOPe Domain Sequences for d1r33a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r33a2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOPe Domain Coordinates for d1r33a2:

Click to download the PDB-style file with coordinates for d1r33a2.
(The format of our PDB-style files is described here.)

Timeline for d1r33a2: