Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) |
Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
Protein Golgi alpha-mannosidase II [88694] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries) Uniprot Q24451 94-1107 |
Domain d1r33a1: 1r33 A:412-522 [111667] Other proteins in same PDB: d1r33a2, d1r33a3 complexed with lka, mpd, nag, zn |
PDB Entry: 1r33 (more details), 1.8 Å
SCOPe Domain Sequences for d1r33a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r33a1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs
Timeline for d1r33a1: