Lineage for d1qw7b_ (1qw7 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 971705Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
  6. 971706Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species)
  7. 971726Species Pseudomonas diminuta [TaxId:293] [51566] (17 PDB entries)
    Uniprot P0A434 30-365
  8. 971751Domain d1qw7b_: 1qw7 B: [111661]
    complexed with co, ebp, na

Details for d1qw7b_

PDB Entry: 1qw7 (more details), 1.9 Å

PDB Description: structure of an engineered organophosphorous hydrolase with increased activity toward hydrolysis of phosphothiolate bonds
PDB Compounds: (B:) Parathion hydrolase

SCOPe Domain Sequences for d1qw7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qw7b_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
eqqaaifeseglspsrvcighsddtddlsyltalaargyligldriphsaiglednasas
allgirswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafip
lrvipflrekgvpqetlagitvtnparflsptlras

SCOPe Domain Coordinates for d1qw7b_:

Click to download the PDB-style file with coordinates for d1qw7b_.
(The format of our PDB-style files is described here.)

Timeline for d1qw7b_: