SCOPe 2.07: Domain d1qvpa1: 1qvp A:144-226

Lineage for d1qvpa1 (1qvp A:144-226)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
   Uniprot P33120

8. Domain d1qvpa1: 1qvp A:144-226 [111659]
   Other proteins in same PDB: d1qvpa2
   C-terminal domain only

Details for d1qvpa1

PDB Entry: 1qvp

PDB Description: c terminal sh3-like domain from diphtheria toxin repressor residues 144-226.

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1qvpa1:

Sequence; same for both SEQRES and ATOM records:

>d1qvpa1 b.34.1.2 (A:144-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
daaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghit
lshngkdvellddlahtirieel

Timeline for d1qvpa1:

• d1qvpa1 first appeared in SCOP 1.71, called d1qvpa_
  
• d1qvpa1 appears in SCOPe 2.06
  
• d1qvpa1 appears in the current release, SCOPe 2.08