Lineage for d1q9ha_ (1q9h A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043561Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 protein domains)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2043562Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (7 species)
  7. 2043589Species Talaromyces emersonii [TaxId:68825] [117136] (1 PDB entry)
    Uniprot Q8TFL9
  8. 2043590Domain d1q9ha_: 1q9h A: [111658]
    complexed with nag

Details for d1q9ha_

PDB Entry: 1q9h (more details), 2.35 Å

PDB Description: 3-Dimensional structure of native Cel7A from Talaromyces emersonii
PDB Compounds: (A:) cellobiohydrolase I catalytic domain

SCOPe Domain Sequences for d1q9ha_:

Sequence, based on SEQRES records: (download)

>d1q9ha_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Talaromyces emersonii [TaxId: 68825]}
eqagtataenhppltwqectapgscttqngavvldanwrwvhdvngytncytgntwdpty
cpddetcaqncaldgadyegtygvtssgsslklnfvtgsnvgsrlyllqddstyqifkll
nrefsfdvdvsnlpcglngalyfvamdadggvskypnnkagakygtgycdsqcprdlkfi
dgeanvegwqpssnnantgigdhgsccaemdvweansisnavtphpcdtpgqtmcsgddc
ggtysndryagtcdpdgcdfnpyrmgntsfygpgkiidttkpftvvtqfltddgtdtgtl
seikrfyiqnsnvipqpnsdisgvtgnsittefctaqkqafgdtddfsqhgglakmgaam
qqgmvlvmslwddyaaqmlwldsdyptdadpttpgiargtcptdsgvpsdvesqspnsyv
tysnikfgpinstft

Sequence, based on observed residues (ATOM records): (download)

>d1q9ha_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Talaromyces emersonii [TaxId: 68825]}
eqagtataenhppltwqectapgscttqngavvldanwrwvhdvngytncytgntwdpty
cpddetcaqncaldgadyegtygvtssgsslklnfvtgsnvgsrlyllqddstyqifkll
nrefsfdvdvsnlpcglngalyfvamdadggvskypnnkagakygtgycdsqcprdlkfi
dgeanvegwqpstgigdhgsccaemdvweansisnavtphpcdtpgqtmcsgddcggtys
ndryagtcdpdgcdfnpyrmgntsfygpgkiidttkpftvvtqfltddgtdtgtlseikr
fyiqnsnvipqpnsdisgvtgnsittefctaqkqafgdtddfsqhgglakmgaamqqgmv
lvmslwddyaaqmlwldsdyptdadpttpgiargtcptdsgvpsdvesqspnsyvtysni
kfgpinstft

SCOPe Domain Coordinates for d1q9ha_:

Click to download the PDB-style file with coordinates for d1q9ha_.
(The format of our PDB-style files is described here.)

Timeline for d1q9ha_: