SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q6za3 (1q6z A:342-524)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108535Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 protein domains)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2108559Protein Benzoylformate decarboxylase [88756] (1 species)
  7. 2108560Species Pseudomonas putida [TaxId:303] [88757] (7 PDB entries)
    Uniprot P20906
  8. 2108561Domain d1q6za3: 1q6z A:342-524 [111657]
    Other proteins in same PDB: d1q6za1, d1q6za2
    complexed with ca, mg, tzd; mutant

Details for d1q6za3

PDB Entry: 1q6z (more details), 1 Å

PDB Description: high resolution structure of e28a mutant benzoylformate decarboxylase from pseudomonas putida complexed with thiamin thiazolone diphosphate
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1q6za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stv

SCOPe Domain Coordinates for d1q6za3:

Click to download the PDB-style file with coordinates for d1q6za3.
(The format of our PDB-style files is described here.)

Timeline for d1q6za3: