Lineage for d1q60a_ (1q60 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617284Fold d.288: GTF2I-like repeat [117772] (1 superfamily)
    alpha(2)-beta-alpha-beta-alpha; 2 layers: a/b; antiparallel beta-ribbon
  4. 617285Superfamily d.288.1: GTF2I-like repeat [117773] (1 family) (S)
  5. 617286Family d.288.1.1: GTF2I-like repeat [117774] (1 protein)
    Pfam 02946
  6. 617287Protein General transcription factor II-I [117775] (1 species)
    there are six GTF2I-like repeats in this protein
  7. 617288Species Mouse (Mus musculus) [TaxId:10090] [117776] (1 PDB entry)
  8. 617289Domain d1q60a_: 1q60 A: [111654]
    5th repeat (SQ res 733-823)

Details for d1q60a_

PDB Entry: 1q60 (more details)

PDB Description: solution structure of rsgi ruh-004, a gtf2i domain in mouse cdna

SCOP Domain Sequences for d1q60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q60a_ d.288.1.1 (A:) General transcription factor II-I {Mouse (Mus musculus)}
gssgssglkqkvenlfnekcgealglkqavkvpfalfesfpedfyveglpegvpfrrpst
fgiprlekilrnkakikfiikkpemfetaikessgpssg

SCOP Domain Coordinates for d1q60a_:

Click to download the PDB-style file with coordinates for d1q60a_.
(The format of our PDB-style files is described here.)

Timeline for d1q60a_: