Lineage for d1q60a1 (1q60 A:8-93)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566283Fold d.288: GTF2I-like repeat [117772] (1 superfamily)
    alpha(2)-beta-alpha-beta-alpha; 2 layers: a/b; antiparallel beta-ribbon
  4. 2566284Superfamily d.288.1: GTF2I-like repeat [117773] (2 families) (S)
    automatically mapped to Pfam PF02946
  5. 2566285Family d.288.1.1: GTF2I-like repeat [117774] (2 proteins)
    Pfam PF02946
  6. 2566286Protein General transcription factor II-I [117775] (1 species)
    there are six GTF2I-like repeats in this protein
  7. 2566287Species Mouse (Mus musculus) [TaxId:10090] [117776] (1 PDB entry)
    Uniprot Q9ESZ8
  8. 2566288Domain d1q60a1: 1q60 A:8-93 [111654]
    Other proteins in same PDB: d1q60a2, d1q60a3
    5th repeat (SQ res 733-823)

Details for d1q60a1

PDB Entry: 1q60 (more details)

PDB Description: Solution Structure of RSGI RUH-004, a GTF2I domain in Mouse cDNA
PDB Compounds: (A:) General transcription factor II-I

SCOPe Domain Sequences for d1q60a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q60a1 d.288.1.1 (A:8-93) General transcription factor II-I {Mouse (Mus musculus) [TaxId: 10090]}
lkqkvenlfnekcgealglkqavkvpfalfesfpedfyveglpegvpfrrpstfgiprle
kilrnkakikfiikkpemfetaikes

SCOPe Domain Coordinates for d1q60a1:

Click to download the PDB-style file with coordinates for d1q60a1.
(The format of our PDB-style files is described here.)

Timeline for d1q60a1: