![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.288: GTF2I-like repeat [117772] (1 superfamily) alpha(2)-beta-alpha-beta-alpha; 2 layers: a/b; antiparallel beta-ribbon |
![]() | Superfamily d.288.1: GTF2I-like repeat [117773] (2 families) ![]() automatically mapped to Pfam PF02946 |
![]() | Family d.288.1.1: GTF2I-like repeat [117774] (2 proteins) Pfam PF02946 |
![]() | Protein General transcription factor II-I [117775] (1 species) there are six GTF2I-like repeats in this protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117776] (1 PDB entry) Uniprot Q9ESZ8 |
![]() | Domain d1q60a1: 1q60 A:8-93 [111654] Other proteins in same PDB: d1q60a2, d1q60a3 5th repeat (SQ res 733-823) |
PDB Entry: 1q60 (more details)
SCOPe Domain Sequences for d1q60a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q60a1 d.288.1.1 (A:8-93) General transcription factor II-I {Mouse (Mus musculus) [TaxId: 10090]} lkqkvenlfnekcgealglkqavkvpfalfesfpedfyveglpegvpfrrpstfgiprle kilrnkakikfiikkpemfetaikes
Timeline for d1q60a1: