SCOPe 2.08: Domain d1q31b_: 1q31 B:

Lineage for d1q31b_ (1q31 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species)

7. Species Tobacco etch virus, TEV [TaxId:12227] [82127] (3 PDB entries)
   Uniprot P04517 2041-2279

8. Domain d1q31b_: 1q31 B: [111651]
   complexed with bme; mutant

Details for d1q31b_

PDB Entry: 1q31, 2.7 Å

PDB Description: crystal structure of the tobacco etch virus protease c151a mutant

PDB Compounds: (B:) Nuclear inclusion protein A

SCOPe Domain Sequences for d1q31b_:

Sequence, based on SEQRES records:

>d1q31b_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]}
lfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgv
fkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmss
mvsdtsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvp
knfmelltnqeaqqwvsgwrlnadsvlwgghkvfmskpeepfqpvkeatqlmnelvysq

Sequence, based on observed residues (ATOM records):

>d1q31b_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]}
lfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgv
fkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmss
mvsdtsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvp
knfmelltnqeaqqwvsgwrlnadsvlwgghkvfmskpmnelvysq

Timeline for d1q31b_:

• d1q31b_ first appeared in SCOP 1.71
  
• d1q31b_ appears in SCOPe 2.07