Lineage for d1q13b_ (1q13 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570948Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 570949Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 570961Protein 20alpha-hydroxysteroid dehydrogenase [109609] (2 species)
  7. 570964Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110348] (2 PDB entries)
  8. 570968Domain d1q13b_: 1q13 B: [111649]
    complexed with nap, so4, tes

Details for d1q13b_

PDB Entry: 1q13 (more details), 2.08 Å

PDB Description: crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with nadp and testosterone

SCOP Domain Sequences for d1q13b_:

Sequence, based on SEQRES records: (download)

>d1q13b_ c.1.7.1 (B:) 20alpha-hydroxysteroid dehydrogenase {Rabbit (Oryctolagus cuniculus)}
dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli
galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr
nfryvtadfaighpnypfsdey

Sequence, based on observed residues (ATOM records): (download)

>d1q13b_ c.1.7.1 (B:) 20alpha-hydroxysteroid dehydrogenase {Rabbit (Oryctolagus cuniculus)}
dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepsapvlledpligalak
khqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnrnfryv
tadfaighpnypfsdey

SCOP Domain Coordinates for d1q13b_:

Click to download the PDB-style file with coordinates for d1q13b_.
(The format of our PDB-style files is described here.)

Timeline for d1q13b_: